PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AS_6C2F49AE0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 479aa    MW: 51035 Da    PI: 5.6955
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AS_6C2F49AE0.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.52.9e-38102162262
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            ++k+l+cprC+s++tkfCyynny+++qPr+fC++C+ryWt+GG++rn+PvG+grrk+k+ss
  Traes_2AS_6C2F49AE0.1 102 PDKILPCPRCNSMDTKFCYYNNYNIHQPRHFCRGCQRYWTAGGSMRNLPVGAGRRKSKSSS 162
                            7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2999159IPR003851Zinc finger, Dof-type
PfamPF027012.7E-31104160IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.127106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MELAGAAHPQ PPESDVAPPR TPPQAPAEDS CKDTGDTRIT EENSCTPPDL NLSQPNNSGL  60
NSSSACENQT SNGDEMTEPE STLEAAKTEG DGSNKEKVLK KPDKILPCPR CNSMDTKFCY  120
YNNYNIHQPR HFCRGCQRYW TAGGSMRNLP VGAGRRKSKS SSTNCNGILI PGDSLSAPGG  180
DASVIPLPIK ENQPAVKFGS DSTLPNSMAS LLRVEEQNKN SNPASTAHPR NGENQTCPPS  240
ATTSDNPRIE SVKVAVGVHQ NGITGDCNGV TPMPPIPCFP GAPFMYPWNP AWNGVPAMAA  300
PVCPVPAEPA NCSENGHGGN IQWNFPPMVP MPGFCGPPIP FPVMPPSIWP LVSPWPNGAW  360
SAPWLGPAYN MSAAPPTSSS TCSDSGSPVL GKHPRDSEPQ GGEKAERSLW IPKTLRIDDP  420
DEAAKSSIWT TLGIEPGERG MFRAFQPKSG GREQMSNAAR VMQANPAAQS RFASFQETT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3588050.0AK358805.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1083I10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233788.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLW5B2530.0W5B253_WHEAT; Uncharacterized protein
STRINGMLOC_19593.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-69cycling DOF factor 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]